PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000201509
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family Dof
Protein Properties Length: 470aa    MW: 51230.7 Da    PI: 9.1674
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000201509genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.82.3e-38176235261
         zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                    +++alkcprCds +tkfCyynny+lsqPr+fCkaCrryWtkGG lrnvPvGgg+rk k+s
  MDP0000201509 176 NQQALKCPRCDSLHTKFCYYNNYNLSQPRHFCKACRRYWTKGGVLRNVPVGGGCRKXKRS 235
                    57899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-26177234IPR003851Zinc finger, Dof-type
PfamPF027011.5E-32178234IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.18180234IPR003851Zinc finger, Dof-type
PROSITE patternPS013610182218IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MKRASELESR QSLYITLRAH SRPYITQLPT LEASQQTTSL TFRNVALSPP VMFLPIKLGW  60
PTRRQSSRSS TVRPRVVNQR PDLIPLPCLH GSCDSWTWTS KGCFGLFATP SIGQCHWVIC  120
LRRGANLGSI NFPGKFSNPS NTVIEMQDIY SVRGGGRFFG GSGGGDRRLR PHQHPNQQAL  180
KCPRCDSLHT KFCYYNNYNL SQPRHFCKAC RRYWTKGGVL RNVPVGGGCR KXKRSKPKNS  240
SSSSPTSSPP PPPPQPNSAD QNKSSSHSSS ESSSLTNPTA XAATAXTEAV SAPSSTGSAS  300
NLLTNIHNPE SKFFVSQGGA NGGFEPXXSA AALLEQITEI NGLFSEIGSF TSLITSSNDV  360
PFSFGNINGS PFDQPAQVGN HHHNQVHQNQ WGQQNQEGKM QEISGGLLDQ TAQVDLSVFQ  420
NRSNGVGGGE FGPLDWQPGS VDQGLFDLPN TVDWSQGQWA DQDHPTLYLP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.123880.0fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572542e-54DQ857254.1 Glycine max Dof4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008393380.10.0PREDICTED: uncharacterized protein LOC103455572
TrEMBLD9ZIX71e-160D9ZIX7_MALDO; DOF domain class transcription factor
STRINGPOPTR_0015s03520.11e-77(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.17e-33OBF binding protein 4